5-Bromopicolinamide
CAS: 90145-48-5
Ref. 3D-FB153951
| 1g | To inquire | |
| 2g | To inquire | |
| 5g | To inquire | |
| 10g | To inquire | |
| 500mg | To inquire |
Product Information
- 2-Pyridinecarboxamide, 5-Bromo-
5-Bromopicolinamide is a matrix-assisted laser desorption/ionization (MALDI) proteolytic peptide. It has been shown to be effective at cleaving myoglobin, which is an important part of the muscle protein that stores oxygen for use during exercise. 5-Bromopicolinamide is also able to detect the presence of phosphorylation sites on proteins. This compound is used as a substrate in MALDI mass spectrometry and has been successfully applied to the identification of phosphorylation sites on myoglobin and other proteins. The amino acid sequence of this compound has also been determined and annotated in databases such as UniProtKB/Swiss-Prot and NCBI Protein database.br>br>
br>
Sequences:
br>br>
METDVVELLHLEQLAQERELKLNVEGAEAVAKRRKDGLATTVSPSNTPGGGGRL
Chemical properties
Technical inquiry about: 3D-FB153951 5-Bromopicolinamide
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
